LinuxQuestions.org
Welcome to the most active Linux Forum on the web.
Go Back   LinuxQuestions.org > Forums > Linux Forums > Linux - Newbie
User Name
Password
Linux - Newbie This Linux forum is for members that are new to Linux.
Just starting out and have a question? If it is not in the man pages or the how-to's this is the place!

Notices

Reply
 
Search this Thread
Old 08-02-2012, 05:50 PM   #1
kmkocot
Member
 
Registered: Dec 2007
Location: Queensland, Australia
Posts: 98

Rep: Reputation: 15
Tool like diff to compare two files & make graphical output highlighting differences?


Hi all,

I a large dataset of paired files representing amino acid sequences for a particular gene from different organisms. One file in each pair is a modified version of the other in which certain parts have been trimmed out. I need to manually evaluate the results of this trimming and would like to make figures out of some of the files as examples.

Is there a program like diff that could take two files and produce something like a pdf output in which parts of the file that differ are somehow highlighted?

Here's an example of an input file pair (the sequences themselves do not have any line breaks in them):
Code:
>1
DDFKIAVCSSNQNRSMEAHSFLSKKGFNVKSFGTGNMVKLPGPAPDKPNVYDFSITYDAMYRDLMQKDYELYTQNGILHMLDRNRRIKAHPERFQDSTERFDLLITCEERVYDQVLEDFENKEKQAVHIINIDIQDDHEEATIGAFMVCELVTMLYASDDLDNEVDEILQEFEHKVKRSVLHTAQ
>2
HEFRIAVCSSNQNRSMEAHSFLSKKGFCVKSFGTGNMVKLPGPAPDKPNIYDFSITYDAMYRDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAVHIINIDIQDNHEEATIGAFMICELVTMLFASEDLDNEIDEILQEFEHKVNRPVLHTVQ
>3
EILRIAVCSSNQNRSMEAHNFLSKRGFNVKSFGSGTHVKLPGPSPDRPNIYDFTTTYDQMYRDLIEKDKNLYTQNGLLHMLDRNRRIKEKPQRFQSCPDHFDLIITCEERVYDQVVEDLENRDNESCHIINIDIQDNHEEATIGAFMICDLVAMLAKCEDLDNEVDEMVQEFEGQCQDPCCTRLF
Code:
>1
DDFKIAVCSSNQNRSMEAHSFLSKKGFNVKSFGTGNMVKLPGPAPDKPNVYDFSITYDAMYRDLMQKDYELYTQNGILHMLDRNRRIKAHPERFQDSTERFDLLITCEERVYDQVLEDFENKEKQAVHIINIDIQDDHEEATIGAFMVCELVTMLYASDDLDNEVDEILQEFEHKVKRSVLHTAQ
>2
HEFRIAVCSSNQNRSMEAHSFLSKKGFCVKSFGTGNMVKLPGPAPDKPNIYDFSITYDAMYRDL                                                            QAVHIINIDIQDNHEEATIGAFMICELVTMLFASEDLDNEIDEILQEFEHKVNRPVLHTVQ
>3
EILRIAVCSSNQNRSMEAHNFLSKRGFNVKSFGSGTHVKLPGPSPDRPNIYDFTTTYDQMYRDLIEKDKNLYTQNGLLHMLDRNRRIKEKPQRFQSCPDHFDLIITCEERVYDQVVEDLENR     HIINIDIQDNHEEATIGAFMICDLVAMLAKCEDLDNEVDEMVQEFE
Any suggestions on how I could do this would be greatly appreciated!!!

Best,
Kevin
 
Old 08-02-2012, 09:26 PM   #2
schneidz
Senior Member
 
Registered: May 2005
Location: boston, usa
Distribution: fc-15/ fc-20-live-usb/ aix
Posts: 3,917

Rep: Reputation: 599Reputation: 599Reputation: 599Reputation: 599Reputation: 599Reputation: 599
i would do a byte to byte compare on the two sets in c and write them out to an xml file where you can change the color for non matched bytes.
 
  


Reply


Thread Tools Search this Thread
Search this Thread:

Advanced Search

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is Off
HTML code is Off


Similar Threads
Thread Thread Starter Forum Replies Last Post
How to compare/diff a range of lines from two text files jedibrand Linux - Software 1 03-26-2010 01:54 PM
[SOLVED] Trying to compare two files and output it into a third file. chutsu Programming 11 07-31-2009 06:55 PM
good graphical diff comparisson tool? hedpe Linux - Software 1 11-27-2006 08:17 PM
Can diff display the differences/uniques for just one of the 2 files? gruffy Linux - Newbie 4 09-10-2006 02:17 PM
Diff compare 2 files DavidTempler Linux - Newbie 2 11-01-2004 10:00 AM


All times are GMT -5. The time now is 05:44 PM.

Main Menu
My LQ
Write for LQ
LinuxQuestions.org is looking for people interested in writing Editorials, Articles, Reviews, and more. If you'd like to contribute content, let us know.
Main Menu
Syndicate
RSS1  Latest Threads
RSS1  LQ News
Twitter: @linuxquestions
identi.ca: @linuxquestions
Facebook: linuxquestions Google+: linuxquestions
Open Source Consulting | Domain Registration